Lineage for d1hi6a1 (1hi6 A:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452039Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
  8. 452199Domain d1hi6a1: 1hi6 A:1-107 [20336]
    Other proteins in same PDB: d1hi6a2, d1hi6b1, d1hi6b2
    part of anti-gp120 (HIV-1) Fab CB 4-1

Details for d1hi6a1

PDB Entry: 1hi6 (more details), 2.55 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

SCOP Domain Sequences for d1hi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi6a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

SCOP Domain Coordinates for d1hi6a1:

Click to download the PDB-style file with coordinates for d1hi6a1.
(The format of our PDB-style files is described here.)

Timeline for d1hi6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hi6a2