SCOP 1.55: Domain d1hi6a1: 1hi6 A:1-107

Lineage for d1hi6a1 (1hi6 A:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)

8. Domain d1hi6a1: 1hi6 A:1-107 [20336]
   Other proteins in same PDB: d1hi6a2, d1hi6b2

Details for d1hi6a1

PDB Entry: 1hi6, 2.55 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide

SCOP Domain Sequences for d1hi6a1:

Sequence; same for both SEQRES and ATOM records:

>d1hi6a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

Timeline for d1hi6a1:

• d1hi6a1 appears in SCOP 1.57
  
• d1hi6a1 appears in the current release, SCOPe 2.08