Lineage for d1zptb_ (1zpt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089931Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2089932Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 protein domains)
    automatically mapped to Pfam PF02219
  6. 2089933Protein Methylenetetrahydrofolate reductase [51732] (2 species)
  7. 2089934Species Escherichia coli [TaxId:562] [51733] (7 PDB entries)
  8. 2089948Domain d1zptb_: 1zpt B: [203359]
    automated match to d1b5tb_
    complexed with fad, nai, so4

Details for d1zptb_

PDB Entry: 1zpt (more details), 1.95 Å

PDB Description: escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25
PDB Compounds: (B:) 5,10-Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d1zptb_:

Sequence, based on SEQRES records: (download)

>d1zptb_ c.1.23.1 (B:) Methylenetetrahydrofolate reductase {Escherichia coli [TaxId: 562]}
ffhasqrdalnqslaevqgqinvsfeffpprtsemeqtlwnsidrlsslkpkfvsvtyga
nsgerdrthsiikgikdrtgleaaphltcidatpdelrtiardywnngirhivalrgdlp
pgsgkpemyasdlvtllkevadfdisvaaypevhpeaksaqadllnlkrkvdaganrait
qfffdvesylrfrdrcvsagidveiipgilpvsnfkqakkfadmtnvripawmaqmfdgl
dddaetrklvganiamdmvkilsregvkdfhfytlnraemsyaichtlgvrp

Sequence, based on observed residues (ATOM records): (download)

>d1zptb_ c.1.23.1 (B:) Methylenetetrahydrofolate reductase {Escherichia coli [TaxId: 562]}
ffhasqrdalnqslaevqgqinvsfeffpprtsemeqtlwnsidrlsslkpkfvsvtyga
nsgerdrthsiikgikdrtgleaaphltcidatpdelrtiardywnngirhivalrgdle
myasdlvtllkevadfdisvaaypevhpeaksaqadllnlkrkvdaganraitqfffdve
sylrfrdrcvsagidveiipgilpvsnfkqakkfadmtnvripawmaqmfdgldddaetr
klvganiamdmvkilsregvkdfhfytlnraemsyaichtlgvrp

SCOPe Domain Coordinates for d1zptb_:

Click to download the PDB-style file with coordinates for d1zptb_.
(The format of our PDB-style files is described here.)

Timeline for d1zptb_: