![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:196620] [225001] (1 PDB entry) |
![]() | Domain d1zowd2: 1zow D:176-312 [203351] automated match to d1ub7a2 |
PDB Entry: 1zow (more details), 2 Å
SCOPe Domain Sequences for d1zowd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zowd2 c.95.1.0 (D:176-312) automated matches {Staphylococcus aureus [TaxId: 196620]} isyemgsdgtggkhlyldkdtgklkmngrevfkfavrimgdastrvvekanltsddidlf iphqanirimesarerlgiskdkmsvsvnkygntsaasiplsidqelkngklkdddtivl vgfgggltwgamtikwg
Timeline for d1zowd2: