Lineage for d1zowd2 (1zow D:176-312)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918280Species Staphylococcus aureus [TaxId:196620] [225001] (1 PDB entry)
  8. 2918288Domain d1zowd2: 1zow D:176-312 [203351]
    automated match to d1ub7a2

Details for d1zowd2

PDB Entry: 1zow (more details), 2 Å

PDB Description: Crystal Structure of S. aureus FabH, beta-ketoacyl carrier protein synthase III
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase III

SCOPe Domain Sequences for d1zowd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zowd2 c.95.1.0 (D:176-312) automated matches {Staphylococcus aureus [TaxId: 196620]}
isyemgsdgtggkhlyldkdtgklkmngrevfkfavrimgdastrvvekanltsddidlf
iphqanirimesarerlgiskdkmsvsvnkygntsaasiplsidqelkngklkdddtivl
vgfgggltwgamtikwg

SCOPe Domain Coordinates for d1zowd2:

Click to download the PDB-style file with coordinates for d1zowd2.
(The format of our PDB-style files is described here.)

Timeline for d1zowd2: