| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries) |
| Domain d1bogb1: 1bog B:1-112 [20335] Other proteins in same PDB: d1boga2, d1bogb2 |
PDB Entry: 1bog (more details), 2.6 Å
SCOP Domain Sequences for d1bogb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bogb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsa
Timeline for d1bogb1: