Lineage for d1bogb1 (1bog B:1-112)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219146Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)
  8. 219148Domain d1bogb1: 1bog B:1-112 [20335]
    Other proteins in same PDB: d1boga2, d1bogb2

Details for d1bogb1

PDB Entry: 1bog (more details), 2.6 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide

SCOP Domain Sequences for d1bogb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bogb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsa

SCOP Domain Coordinates for d1bogb1:

Click to download the PDB-style file with coordinates for d1bogb1.
(The format of our PDB-style files is described here.)

Timeline for d1bogb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bogb2