SCOPe 2.08: Domain d1zl9b2: 1zl9 B:80-207

Lineage for d1zl9b2 (1zl9 B:80-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224980] (2 PDB entries)

8. Domain d1zl9b2: 1zl9 B:80-207 [203343]
   Other proteins in same PDB: d1zl9a1, d1zl9b1
   automated match to d1tw9a1
   complexed with gsh

Details for d1zl9b2

PDB Entry: 1zl9, 2.01 Å

PDB Description: crystal structure of a major nematode c.elegans specific gst (ce01613)

PDB Compounds: (B:) glutathione S-transferase 5

SCOPe Domain Sequences for d1zl9b2:

Sequence; same for both SEQRES and ATOM records:

>d1zl9b2 a.45.1.0 (B:80-207) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ngktaweeaqvnsladqykdyssearpyfyavmgfgpgdvetlkkdiflpafekfygflv
nflkasgsgflvgdsltwidlaiaqhsadliakggdfskfpelkahaekiqaipqikkwi
etrpvtpf

Timeline for d1zl9b2:

• d1zl9b2 first appeared in SCOPe 2.03
  
• d1zl9b2 appears in SCOPe 2.07