SCOPe 2.05: Domain d1zl9b1: 1zl9 B:1-79

Lineage for d1zl9b1 (1zl9 B:1-79)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224979] (2 PDB entries)

8. Domain d1zl9b1: 1zl9 B:1-79 [203342]
   Other proteins in same PDB: d1zl9a2, d1zl9b2
   automated match to d1tw9a2
   complexed with gsh

Details for d1zl9b1

PDB Entry: 1zl9, 2.01 Å

PDB Description: crystal structure of a major nematode c.elegans specific gst (ce01613)

PDB Compounds: (B:) glutathione S-transferase 5

SCOPe Domain Sequences for d1zl9b1:

Sequence; same for both SEQRES and ATOM records:

>d1zl9b1 c.47.1.0 (B:1-79) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mvsykltyfngrgagevsrqifayagqqyednrvtqeqwpalketcaapfgqlpflevdg
kklaqshaiarflarefkl

Timeline for d1zl9b1:

• d1zl9b1 first appeared in SCOPe 2.03
  
• d1zl9b1 appears in SCOPe 2.04
  
• d1zl9b1 appears in SCOPe 2.06
  
• d1zl9b1 appears in the current release, SCOPe 2.08