| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224979] (2 PDB entries) |
| Domain d1zl9b1: 1zl9 B:1-79 [203342] Other proteins in same PDB: d1zl9a2, d1zl9b2 automated match to d1tw9a2 complexed with gsh |
PDB Entry: 1zl9 (more details), 2.01 Å
SCOPe Domain Sequences for d1zl9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl9b1 c.47.1.0 (B:1-79) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mvsykltyfngrgagevsrqifayagqqyednrvtqeqwpalketcaapfgqlpflevdg
kklaqshaiarflarefkl
Timeline for d1zl9b1: