Lineage for d1boga1 (1bog A:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7146Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries)
  8. 7147Domain d1boga1: 1bog A:1-107 [20334]
    Other proteins in same PDB: d1boga2, d1bogb2

Details for d1boga1

PDB Entry: 1bog (more details), 2.6 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide

SCOP Domain Sequences for d1boga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boga1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain}
dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk

SCOP Domain Coordinates for d1boga1:

Click to download the PDB-style file with coordinates for d1boga1.
(The format of our PDB-style files is described here.)

Timeline for d1boga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1boga2