SCOPe 2.08: Domain d1zk9a1: 1zk9 A:277-378

Lineage for d1zk9a1 (1zk9 A:277-378)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein automated matches [226855] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)

8. Domain d1zk9a1: 1zk9 A:277-378 [203338]
   Other proteins in same PDB: d1zk9a2
   automated match to d1my7a_

Details for d1zk9a1

PDB Entry: 1zk9, 2.18 Å

PDB Description: nf-kb relb forms an intertwined homodimer

PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d1zk9a1:

Sequence; same for both SEQRES and ATOM records:

>d1zk9a1 b.1.18.1 (A:277-378) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ntselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqia
ivfktppyedleisepvtvnvflqrltdgvcseplpftylpr

Timeline for d1zk9a1:

• d1zk9a1 first appeared in SCOPe 2.03, called d1zk9a_
  
• d1zk9a1 appears in SCOPe 2.07