SCOPe 2.05: Domain d1zjba1: 1zjb A:2-478

Lineage for d1zjba1 (1zjb A:2-478)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries)

8. Domain d1zjba1: 1zjb A:2-478 [203334]
   Other proteins in same PDB: d1zjba2, d1zjbb2
   automated match to d1m53a2
   complexed with ca, trs

Details for d1zjba1

PDB Entry: 1zjb, 1.8 Å

PDB Description: Crystal structure of the trehalulose synthase MutB from Pseudomonas mesoacidophila MX-45 (monoclinic form)

PDB Compounds: (A:) Trehalulose synthase

SCOPe Domain Sequences for d1zjba1:

Sequence; same for both SEQRES and ATOM records:

>d1zjba1 c.1.8.1 (A:2-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst

Timeline for d1zjba1:

• d1zjba1 first appeared in SCOPe 2.03
  
• d1zjba1 appears in SCOPe 2.04
  
• d1zjba1 appears in SCOPe 2.06
  
• d1zjba1 appears in the current release, SCOPe 2.08