SCOPe 2.03: Domain d1zjaa2: 1zja A:479-557

Lineage for d1zjaa2 (1zja A:479-557)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)

8. Domain d1zjaa2: 1zja A:479-557 [203331]
   Other proteins in same PDB: d1zjaa1, d1zjab1
   automated match to d1m53a1
   complexed with ca, trs

Details for d1zjaa2

PDB Entry: 1zja, 1.6 Å

PDB Description: Crystal structure of the trehalulose synthase MutB from Pseudomonas mesoacidophila MX-45 (triclinic form)

PDB Compounds: (A:) Trehalulose synthase

SCOPe Domain Sequences for d1zjaa2:

Sequence; same for both SEQRES and ATOM records:

>d1zjaa2 b.71.1.0 (A:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykvk

Timeline for d1zjaa2:

• d1zjaa2 is new in SCOPe 2.03-stable
  
• d1zjaa2 appears in SCOPe 2.04
  
• d1zjaa2 appears in the current release, SCOPe 2.08