Lineage for d1zhfa2 (1zhf A:117-364)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894830Species Medicago truncatula [TaxId:3880] [225108] (10 PDB entries)
  8. 2894846Domain d1zhfa2: 1zhf A:117-364 [203329]
    Other proteins in same PDB: d1zhfa1
    automated match to d1fp2a2
    complexed with sah

Details for d1zhfa2

PDB Entry: 1zhf (more details), 2.5 Å

PDB Description: Crystal structure of selenomethionine substituted isoflavanone 4'-O-methyltransferase
PDB Compounds: (A:) isoflavanone 4'-O-methyltransferase

SCOPe Domain Sequences for d1zhfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhfa2 c.66.1.0 (A:117-364) automated matches {Medicago truncatula [TaxId: 3880]}
tclssivkgalhpssldmwssskkwfnedkeqtlfecatgesfwdflnkdsesstlsmfq
damasdsrmfklvlqenkrvfegleslvdvgggtggvtkliheifphlkctvfdqpqvvg
nltgnenlnfvggdmfksipsadavllkwvlhdwndeqslkilknskeaishkgkdgkvi
iidisidetsddrgltelqldydlvmltmflgkertkqewekliydagfssykitpisgf
kslievyp

SCOPe Domain Coordinates for d1zhfa2:

Click to download the PDB-style file with coordinates for d1zhfa2.
(The format of our PDB-style files is described here.)

Timeline for d1zhfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zhfa1