| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries) |
| Domain d1zgja1: 1zgj A:11-116 [203326] Other proteins in same PDB: d1zgja2 automated match to d1fp2a1 complexed with p1s, sah |
PDB Entry: 1zgj (more details), 2.5 Å
SCOPe Domain Sequences for d1zgja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgja1 a.4.5.0 (A:11-116) automated matches {Medicago truncatula [TaxId: 3880]}
selyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhpskvni
lhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkp
Timeline for d1zgja1: