SCOPe 2.08: Domain d1zg3a1: 1zg3 A:7-116

Lineage for d1zg3a1 (1zg3 A:7-116)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries)

8. Domain d1zg3a1: 1zg3 A:7-116 [203321]
   Other proteins in same PDB: d1zg3a2
   automated match to d1fp2a1
   complexed with 2hi, sah

Details for d1zg3a1

PDB Entry: 1zg3, 2.35 Å

PDB Description: Crystal structure of the isoflavanone 4'-O-methyltransferase complexed with SAH and 2,7,4'-trihydroxyisoflavanone

PDB Compounds: (A:) isoflavanone 4'-O-methyltransferase

SCOPe Domain Sequences for d1zg3a1:

Sequence; same for both SEQRES and ATOM records:

>d1zg3a1 a.4.5.0 (A:7-116) automated matches {Medicago truncatula [TaxId: 3880]}
gseeselyhaqihlykhvynfvssmalksamelgiadaihnhgkpmtlselasslklhps
kvnilhrflrllthngffaktivkgkegdeeeeiaysltppskllisgkp

Timeline for d1zg3a1:

• d1zg3a1 first appeared in SCOPe 2.03
  
• d1zg3a1 appears in SCOPe 2.07