Lineage for d1zcla_ (1zcl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875165Protein automated matches [190696] (6 species)
    not a true protein
  7. 2875250Species Norway rat (Rattus norvegicus) [TaxId:10116] [225022] (2 PDB entries)
  8. 2875253Domain d1zcla_: 1zcl A: [203315]
    automated match to d1v3aa_
    complexed with so4; mutant

Details for d1zcla_

PDB Entry: 1zcl (more details), 2.9 Å

PDB Description: prl-1 c104s mutant in complex with sulfate
PDB Compounds: (A:) protein tyrosine phosphatase 4a1

SCOPe Domain Sequences for d1zcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcla_ c.45.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhsvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

SCOPe Domain Coordinates for d1zcla_:

Click to download the PDB-style file with coordinates for d1zcla_.
(The format of our PDB-style files is described here.)

Timeline for d1zcla_: