SCOPe 2.03: Domain d1zanl2: 1zan L:109-214

Lineage for d1zanl2 (1zan L:109-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (2 PDB entries)

8. Domain d1zanl2: 1zan L:109-214 [203313]
   automated match to d1e4wl2
   complexed with cl

Details for d1zanl2

PDB Entry: 1zan, 1.7 Å

PDB Description: Crystal structure of anti-NGF AD11 Fab

PDB Compounds: (L:) Fab AD11 Light Chain

SCOPe Domain Sequences for d1zanl2:

Sequence; same for both SEQRES and ATOM records:

>d1zanl2 b.1.1.0 (L:109-214) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsseqlasggasvvcllnnfypkdisvkwkidgserqngvldsvtdqd
skdstysmsstltltkaeyeshnsytcevthktstspvvksfnrge

Timeline for d1zanl2:

• d1zanl2 is new in SCOPe 2.03-stable
  
• d1zanl2 appears in SCOPe 2.04
  
• d1zanl2 appears in the current release, SCOPe 2.08