Lineage for d1z9nb_ (1z9n B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763825Species Haemophilus ducreyi [TaxId:730] [188174] (2 PDB entries)
  8. 2763827Domain d1z9nb_: 1z9n B: [203309]
    automated match to d2aqna_
    complexed with cu, hem, zn

Details for d1z9nb_

PDB Entry: 1z9n (more details), 1.5 Å

PDB Description: X-Ray structure of a Cu-Zn superoxide dismutase from Haemophilus ducreyi with haem bound at the dimer interface
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1z9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9nb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Haemophilus ducreyi [TaxId: 730]}
ekivvpvqqldpqngnkdvgtveitesayglvftpklhdlahglhgfhihekpscepkek
dgklvaglgagghwdpkqtqkhgypwsddahmgdlpalfvmhdgsattpvlaprlkklae
vkghslmihaggdnhsdhpaplggggprmacgvik

SCOPe Domain Coordinates for d1z9nb_:

Click to download the PDB-style file with coordinates for d1z9nb_.
(The format of our PDB-style files is described here.)

Timeline for d1z9nb_: