SCOPe 2.04: Domain d1z82a2: 1z82 A:167-313

Lineage for d1z82a2 (1z82 A:167-313)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [224972] (1 PDB entry)

8. Domain d1z82a2: 1z82 A:167-313 [203305]
   Other proteins in same PDB: d1z82a1, d1z82b1
   automated match to d1evya1
   complexed with g3h, g3p, mpd, mrd, ndp

Details for d1z82a2

PDB Entry: 1z82, 2 Å

PDB Description: crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution

PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1z82a2:

Sequence; same for both SEQRES and ATOM records:

>d1z82a2 a.100.1.0 (A:167-313) automated matches {Thermotoga maritima [TaxId: 243274]}
edvvgveiagalknviaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmg
lagigdlmvtcnsrysrnrrfgeliargfnplkllessnqvvegaftvkavmkiakenki
dmpiseevyrvvyegkpplqsmrdlmr

Timeline for d1z82a2:

• d1z82a2 first appeared in SCOPe 2.03
  
• d1z82a2 appears in SCOPe 2.05
  
• d1z82a2 appears in the current release, SCOPe 2.08