| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (23 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [224972] (1 PDB entry) |
| Domain d1z82a2: 1z82 A:167-313 [203305] Other proteins in same PDB: d1z82a1, d1z82b1 automated match to d1evya1 complexed with g3h, g3p, mpd, mrd, ndp |
PDB Entry: 1z82 (more details), 2 Å
SCOPe Domain Sequences for d1z82a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z82a2 a.100.1.0 (A:167-313) automated matches {Thermotoga maritima [TaxId: 243274]}
edvvgveiagalknviaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmg
lagigdlmvtcnsrysrnrrfgeliargfnplkllessnqvvegaftvkavmkiakenki
dmpiseevyrvvyegkpplqsmrdlmr
Timeline for d1z82a2: