Lineage for d1z82a2 (1z82 A:167-313)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721993Species Thermotoga maritima [TaxId:243274] [224972] (1 PDB entry)
  8. 2721994Domain d1z82a2: 1z82 A:167-313 [203305]
    Other proteins in same PDB: d1z82a1, d1z82b1
    automated match to d1evya1
    complexed with g3h, g3p, mpd, mrd, ndp

Details for d1z82a2

PDB Entry: 1z82 (more details), 2 Å

PDB Description: crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1z82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z82a2 a.100.1.0 (A:167-313) automated matches {Thermotoga maritima [TaxId: 243274]}
edvvgveiagalknviaiaagildgfggwdnakaaletrgiyeiarfgmffgadqktfmg
lagigdlmvtcnsrysrnrrfgeliargfnplkllessnqvvegaftvkavmkiakenki
dmpiseevyrvvyegkpplqsmrdlmr

SCOPe Domain Coordinates for d1z82a2:

Click to download the PDB-style file with coordinates for d1z82a2.
(The format of our PDB-style files is described here.)

Timeline for d1z82a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z82a1