Lineage for d1z82a1 (1z82 A:2-166)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581640Species Thermotoga maritima [TaxId:243274] [224971] (1 PDB entry)
  8. 1581641Domain d1z82a1: 1z82 A:2-166 [203304]
    Other proteins in same PDB: d1z82a2, d1z82b2
    automated match to d1evya2
    complexed with g3h, g3p, mpd, mrd, ndp

Details for d1z82a1

PDB Entry: 1z82 (more details), 2 Å

PDB Description: crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (A:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1z82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z82a1 c.2.1.0 (A:2-166) automated matches {Thermotoga maritima [TaxId: 243274]}
emrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtspyveeskitvratn
dleeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgkrvseiveeilgcp
yavlsgpshaeevakklptavtlagenskelqkristeyfrvytc

SCOPe Domain Coordinates for d1z82a1:

Click to download the PDB-style file with coordinates for d1z82a1.
(The format of our PDB-style files is described here.)

Timeline for d1z82a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z82a2