Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries) |
Domain d1z82a1: 1z82 A:2-166 [203304] Other proteins in same PDB: d1z82a2, d1z82b2 automated match to d1evya2 complexed with g3h, g3p, mpd, mrd, ndp |
PDB Entry: 1z82 (more details), 2 Å
SCOPe Domain Sequences for d1z82a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z82a1 c.2.1.0 (A:2-166) automated matches {Thermotoga maritima [TaxId: 243274]} emrffvlgagswgtvfaqmlhengeevilwarrkeivdlinvshtspyveeskitvratn dleeikkedilviaipvqyirehllrlpvkpsmvlnlskgieiktgkrvseiveeilgcp yavlsgpshaeevakklptavtlagenskelqkristeyfrvytc
Timeline for d1z82a1: