![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Clostridium tetani [TaxId:1513] [224976] (2 PDB entries) |
![]() | Domain d1z7ha_: 1z7h A: [203303] automated match to d2fpqa_ complexed with zn |
PDB Entry: 1z7h (more details), 2.3 Å
SCOPe Domain Sequences for d1z7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7ha_ d.92.1.0 (A:) automated matches {Clostridium tetani [TaxId: 1513]} pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnk nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalllmhelihvlhg lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftev elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn afrnvd
Timeline for d1z7ha_: