Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
Protein automated matches [226838] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224982] (2 PDB entries) |
Domain d1z5va1: 1z5v A:2-246 [203301] Other proteins in same PDB: d1z5va2 automated match to d1tubb1 complexed with gsp, mg |
PDB Entry: 1z5v (more details), 2.71 Å
SCOPe Domain Sequences for d1z5va1:
Sequence, based on SEQRES records: (download)
>d1z5va1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} preiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyi pravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdi idreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdv vvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastt tlryp
>d1z5va1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} preiitlqlgqcgnqigfefwkqlcaehgispeaivtdrkdvffyqaddehyipravlld leprvihsilnspyaklynpeniylsgnnwasgfsqgekihedifdiidreadgsdsleg fvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqsdvvvqpynslltlkrltq nadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastttlryp
Timeline for d1z5va1: