| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (45 species) not a true protein |
| Species Peanut (Arachis hypogaea) [TaxId:3818] [225012] (2 PDB entries) |
| Domain d1z1fa2: 1z1f A:236-389 [203294] Other proteins in same PDB: d1z1fa1 automated match to d1bi5a2 complexed with cit, stl |
PDB Entry: 1z1f (more details), 2.9 Å
SCOPe Domain Sequences for d1z1fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1fa2 c.95.1.0 (A:236-389) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
lfeivstdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdy
nsifwiahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksle
aglkttgegldwgvlfgfgpgltietvvlrsmai
Timeline for d1z1fa2: