| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
| Protein automated matches [226868] (1 species) not a true protein |
| Species Peanut (Arachis hypogaea) [TaxId:3818] [225011] (2 PDB entries) |
| Domain d1z1fa1: 1z1f A:2-235 [203293] Other proteins in same PDB: d1z1fa2 automated match to d1cmla1 complexed with cit, stl |
PDB Entry: 1z1f (more details), 2.9 Å
SCOPe Domain Sequences for d1z1fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1fa1 c.95.1.2 (A:2-235) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
vsvsgirkvqraegpatvlaigtanppncvdqstyadyyfrvtnsehmtdlkkkfqrice
rtqiknrhmylteeilkenpnmcaykapsldaredmmirevprvgkeaatkaikewgqpm
skithlifcttsgvalpgvdyelivllgldpsvkrymmyhqgcfaggtvlrlakdlaenn
kdarvlivcsentsvtfrgpsetdmdslvgqalfadgaaaiiigsdpvpevenp
Timeline for d1z1fa1: