SCOPe 2.08: Domain d1z1fa1: 1z1f A:2-235

Lineage for d1z1fa1 (1z1f A:2-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein automated matches [226868] (6 species)
   not a true protein

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [225011] (2 PDB entries)

8. Domain d1z1fa1: 1z1f A:2-235 [203293]
   Other proteins in same PDB: d1z1fa2
   automated match to d1cmla1
   complexed with cit, stl

Details for d1z1fa1

PDB Entry: 1z1f, 2.9 Å

PDB Description: Crystal structure of stilbene synthase from Arachis hypogaea (resveratrol-bound form)

PDB Compounds: (A:) stilbene synthase

SCOPe Domain Sequences for d1z1fa1:

Sequence; same for both SEQRES and ATOM records:

>d1z1fa1 c.95.1.2 (A:2-235) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
vsvsgirkvqraegpatvlaigtanppncvdqstyadyyfrvtnsehmtdlkkkfqrice
rtqiknrhmylteeilkenpnmcaykapsldaredmmirevprvgkeaatkaikewgqpm
skithlifcttsgvalpgvdyelivllgldpsvkrymmyhqgcfaggtvlrlakdlaenn
kdarvlivcsentsvtfrgpsetdmdslvgqalfadgaaaiiigsdpvpevenp

Timeline for d1z1fa1:

• d1z1fa1 first appeared in SCOPe 2.03
  
• d1z1fa1 appears in SCOPe 2.07