![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Peanut (Arachis hypogaea) [TaxId:3818] [225012] (2 PDB entries) |
![]() | Domain d1z1ea2: 1z1e A:236-389 [203292] Other proteins in same PDB: d1z1ea1 automated match to d1bi5a2 complexed with cit |
PDB Entry: 1z1e (more details), 2.4 Å
SCOPe Domain Sequences for d1z1ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ea2 c.95.1.0 (A:236-389) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} lfeivstdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdy nsifwiahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksle aglkttgegldwgvlfgfgpgltietvvlrsmai
Timeline for d1z1ea2: