Lineage for d1z1ea2 (1z1e A:236-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918072Species Peanut (Arachis hypogaea) [TaxId:3818] [225012] (2 PDB entries)
  8. 2918073Domain d1z1ea2: 1z1e A:236-389 [203292]
    Other proteins in same PDB: d1z1ea1
    automated match to d1bi5a2
    complexed with cit

Details for d1z1ea2

PDB Entry: 1z1e (more details), 2.4 Å

PDB Description: Crystal structure of stilbene synthase from Arachis hypogaea
PDB Compounds: (A:) stilbene synthase

SCOPe Domain Sequences for d1z1ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1ea2 c.95.1.0 (A:236-389) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
lfeivstdqqlvpnshgaiggllrevgltfylnksvpdiisqnindalskafdplgisdy
nsifwiahpggraildqveekvnlkpekmkatrdvlsnygnmssacvffimdlmrkksle
aglkttgegldwgvlfgfgpgltietvvlrsmai

SCOPe Domain Coordinates for d1z1ea2:

Click to download the PDB-style file with coordinates for d1z1ea2.
(The format of our PDB-style files is described here.)

Timeline for d1z1ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z1ea1