Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
Domain d1z11c_: 1z11 C: [203289] Other proteins in same PDB: d1z11a2, d1z11b2 automated match to d1dt6a_ complexed with 8mo, hem |
PDB Entry: 1z11 (more details), 2.05 Å
SCOPe Domain Sequences for d1z11c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z11c_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d1z11c_: