Lineage for d1z11b_ (1z11 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278021Species Human (Homo sapiens) [TaxId:9606] [196470] (23 PDB entries)
  8. 1278052Domain d1z11b_: 1z11 B: [203288]
    automated match to d1dt6a_
    complexed with 8mo, hem

Details for d1z11b_

PDB Entry: 1z11 (more details), 2.05 Å

PDB Description: Crystal Structure of Human Microsomal P450 2A6 with Methoxsalen Bound
PDB Compounds: (B:) cytochrome P450, family 2, subfamily A, polypeptide 6

SCOPe Domain Sequences for d1z11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z11b_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavreal
vdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriqe
eagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifqf
tststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfidsf
lirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvheei
drvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgtev
ypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelfl
ffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprh

SCOPe Domain Coordinates for d1z11b_:

Click to download the PDB-style file with coordinates for d1z11b_.
(The format of our PDB-style files is described here.)

Timeline for d1z11b_: