SCOPe 2.08: Domain d1z03c1: 1z03 C:16-163

Lineage for d1z03c1 (1z03 C:16-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [141178] (1 species)

7. Species Pseudomonas putida [TaxId:303] [141179] (3 PDB entries)
   Uniprot O05935 16-163

8. Domain d1z03c1: 1z03 C:16-163 [203260]
   Other proteins in same PDB: d1z03a2, d1z03b2, d1z03c2, d1z03d2, d1z03e2, d1z03f2
   automated match to d1z01a1
   complexed with fe, fes, och

Details for d1z03c1

PDB Entry: 1z03, 1.8 Å

PDB Description: 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction

PDB Compounds: (C:) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component

SCOPe Domain Sequences for d1z03c1:

Sequence; same for both SEQRES and ATOM records:

>d1z03c1 b.33.1.2 (C:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
vttypvhevngmifvfvreddfpdedvp

Timeline for d1z03c1:

• d1z03c1 first appeared in SCOPe 2.03
  
• d1z03c1 appears in SCOPe 2.07