| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
| Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [143823] (1 species) |
| Species Pseudomonas putida [TaxId:303] [143824] (3 PDB entries) Uniprot O05935 164-442 |
| Domain d1z02c2: 1z02 C:164-442 [203249] Other proteins in same PDB: d1z02a1, d1z02b1, d1z02c1, d1z02d1, d1z02e1, d1z02f1 automated match to d1z01a2 complexed with fe, fes |
PDB Entry: 1z02 (more details), 1.8 Å
SCOPe Domain Sequences for d1z02c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z02c2 d.129.3.3 (C:164-442) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
plahdlpfrfperseqfphplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahil
vhkdntivhamdwvlplgllptsddciavvedddgpkgmmqwlftdkwapvlenqelglk
veglkgrhyrtsvvlpgvlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrk
kfqyrydhmykplclhgfndsdlyareamqnfyydgtgwddeqlvatdispitwrklasr
wnrgiakpgrgvagavkdtslifkqtadgkrpgykveqi
Timeline for d1z02c2: