Lineage for d1z02b1 (1z02 B:16-163)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053348Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2053349Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [141178] (1 species)
  7. 2053350Species Pseudomonas putida [TaxId:303] [141179] (3 PDB entries)
    Uniprot O05935 16-163
  8. 2053352Domain d1z02b1: 1z02 B:16-163 [203246]
    Other proteins in same PDB: d1z02a2, d1z02b2, d1z02c2, d1z02d2, d1z02e2, d1z02f2
    automated match to d1z01a1
    complexed with fe, fes

Details for d1z02b1

PDB Entry: 1z02 (more details), 1.8 Å

PDB Description: 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction
PDB Compounds: (B:) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component

SCOPe Domain Sequences for d1z02b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z02b1 b.33.1.2 (B:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
vttypvhevngmifvfvreddfpdedvp

SCOPe Domain Coordinates for d1z02b1:

Click to download the PDB-style file with coordinates for d1z02b1.
(The format of our PDB-style files is described here.)

Timeline for d1z02b1: