Lineage for d1yysb_ (1yys B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282172Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 1282173Protein Trichodiene synthase [69114] (1 species)
  7. 1282174Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 1282214Domain d1yysb_: 1yys B: [203243]
    automated match to d1jfaa_
    complexed with mg, pop, saz

Details for d1yysb_

PDB Entry: 1yys (more details), 2.75 Å

PDB Description: y305f trichodiene synthase: complex with mg, pyrophosphate, and (4s)- 7-azabisabolene
PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d1yysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yysb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
fpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkrl
qaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagreq
ahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflrr
mnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqisl
vknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcdr
rfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1yysb_:

Click to download the PDB-style file with coordinates for d1yysb_.
(The format of our PDB-style files is described here.)

Timeline for d1yysb_: