Class a: All alpha proteins [46456] (284 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.5: Trichodiene synthase [69113] (1 protein) automatically mapped to Pfam PF06330 |
Protein Trichodiene synthase [69114] (1 species) |
Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries) |
Domain d1yyra_: 1yyr A: [203240] automated match to d1jfaa_ complexed with edo, mg, pop, saz |
PDB Entry: 1yyr (more details), 2.5 Å
SCOPe Domain Sequences for d1yyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyra_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]} enfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpk rlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagr eqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqfl rrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqi slvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlc drrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
Timeline for d1yyra_: