Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
Superfamily d.250.1: Folate-binding domain [103025] (2 families) some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins) |
Protein Glycine cleavage system T protein, GcvT [111012] (4 species) |
Species Bacillus subtilis [TaxId:1423] [224968] (1 PDB entry) |
Domain d1yx2a1: 1yx2 A:2-282 [203234] Other proteins in same PDB: d1yx2a2, d1yx2b2 automated match to d1v5va2 complexed with edo |
PDB Entry: 1yx2 (more details), 2.08 Å
SCOPe Domain Sequences for d1yx2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx2a1 d.250.1.1 (A:2-282) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]} lkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgnd slsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkdl awmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgrk alisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniplyg qeltrditpieagigfavkhkkesdffgksvlseqkengak
Timeline for d1yx2a1: