Lineage for d1yx2a1 (1yx2 A:2-282)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946403Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1946404Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1946405Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1946406Protein Glycine cleavage system T protein, GcvT [111012] (4 species)
  7. 1946407Species Bacillus subtilis [TaxId:1423] [224968] (1 PDB entry)
  8. 1946408Domain d1yx2a1: 1yx2 A:2-282 [203234]
    Other proteins in same PDB: d1yx2a2, d1yx2b2
    automated match to d1v5va2
    complexed with edo

Details for d1yx2a1

PDB Entry: 1yx2 (more details), 2.08 Å

PDB Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1yx2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx2a1 d.250.1.1 (A:2-282) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
lkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgnd
slsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkdl
awmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgrk
alisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniplyg
qeltrditpieagigfavkhkkesdffgksvlseqkengak

SCOPe Domain Coordinates for d1yx2a1:

Click to download the PDB-style file with coordinates for d1yx2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yx2a2