SCOPe 2.05: Domain d1ytod_: 1yto D:

Lineage for d1ytod_ (1yto D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1ytod_: 1yto D: [203232]
   automated match to d1q03a_
   complexed with fmt, so4; mutant

Details for d1ytod_

PDB Entry: 1yto, 2.1 Å

PDB Description: Crystal Structure of Gly19 deletion Mutant of Human Acidic Fibroblast Growth Factor

PDB Compounds: (D:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1ytod_:

Sequence; same for both SEQRES and ATOM records:

>d1ytod_ b.42.1.1 (D:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
etgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
gprthygqkailflplpv

Timeline for d1ytod_:

• d1ytod_ first appeared in SCOPe 2.03
  
• d1ytod_ appears in SCOPe 2.04
  
• d1ytod_ is called d1ytod1 in SCOPe 2.06
  
• d1ytod_ appears in the current release, SCOPe 2.08, called d1ytod1