Lineage for d1ytoc1 (1yto C:1G-137)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. Protein Acidic FGF (FGF1) [50357] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. Domain d1ytoc1: 1yto C:1G-137 [203231]
    Other proteins in same PDB: d1ytoa2, d1ytob2, d1ytoc2, d1ytod2
    automated match to d1q03a_
    complexed with fmt, so4; mutant

Details for d1ytoc1

PDB Entry: 1yto (more details), 2.1 Å

PDB Description: Crystal Structure of Gly19 deletion Mutant of Human Acidic Fibroblast Growth Factor
PDB Compounds: (C:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1ytoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytoc1 b.42.1.1 (C:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
rthygqkailflplpv

SCOPe Domain Coordinates for d1ytoc1 are not available.

Timeline for d1ytoc1:

Domains from same chain:
(mouse over for more information)
d1ytoc2
Domains from other chains:
(mouse over for more information)
d1ytoa1, d1ytoa2, d1ytob1, d1ytob2, d1ytod1, d1ytod2