SCOPe 2.07: Domain d1ytoc1: 1yto C:1G-137

Lineage for d1ytoc1 (1yto C:1G-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1ytoc1: 1yto C:1G-137 [203231]
   Other proteins in same PDB: d1ytoa2, d1ytob2, d1ytoc2, d1ytod2
   automated match to d1q03a_
   complexed with fmt, so4; mutant

Details for d1ytoc1

PDB Entry: 1yto, 2.1 Å

PDB Description: Crystal Structure of Gly19 deletion Mutant of Human Acidic Fibroblast Growth Factor

PDB Compounds: (C:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1ytoc1:

Sequence; same for both SEQRES and ATOM records:

>d1ytoc1 b.42.1.1 (C:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
rthygqkailflplpv

Timeline for d1ytoc1:

• d1ytoc1 first appeared in SCOPe 2.03, called d1ytoc_
  
• d1ytoc1 appears in SCOPe 2.06