Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
Protein Nicotinate phosphoribosyltransferase Ta1145 [141861] (1 species) includes extra C-terminal region that wraps around the N-terminal domain and contains a rubredoxin-like subdomain |
Species Thermoplasma acidophilum [TaxId:2303] [141862] (4 PDB entries) Uniprot Q9HJ28 120-389 |
Domain d1ytka2: 1ytk A:120-389 [203228] Other proteins in same PDB: d1ytka1 automated match to d1ytda1 complexed with ncn, trs has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ytk (more details), 2.65 Å
SCOPe Domain Sequences for d1ytka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytka2 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} stkaskvrlaagdspffsfgirrmhpaispmidrsayiggadgvsgilgaklidqdpvgt mphalsimlgdeeawkltlentkngqksvllidtymdekfaaikiaemfdkvdyirldtp ssrrgnfealirevrwelalrgrsdikimvsggldentvkklreagaeafgvgtsissak pfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqektcicggsmqnllv kylshgkrtseyprpkeirsrsmkeleyfk
Timeline for d1ytka2: