SCOPe 2.07: Domain d1ytea1: 1yte A:1-119

Lineage for d1ytea1 (1yte A:1-119)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins)

6. Protein Nicotinate phosphoribosyltransferase Ta1145 [143193] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [143194] (4 PDB entries)
   Uniprot Q9HJ28 1-119

8. Domain d1ytea1: 1yte A:1-119 [203225]
   Other proteins in same PDB: d1ytea2
   automated match to d1ytda2
   complexed with pcp

Details for d1ytea1

PDB Entry: 1yte, 2.75 Å

PDB Description: Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum, phosphoribosylpyrophosphate bound structure

PDB Compounds: (A:) nicotinate phosphoribosyltransferase from Thermoplasma acidophilum

SCOPe Domain Sequences for d1ytea1:

Sequence; same for both SEQRES and ATOM records:

>d1ytea1 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]}
mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldev
lkllegldvdlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgi

Timeline for d1ytea1:

• d1ytea1 first appeared in SCOPe 2.03
  
• d1ytea1 appears in SCOPe 2.06
  
• d1ytea1 appears in the current release, SCOPe 2.08