SCOPe 2.08: Domain d1yspa1: 1ysp A:2-172

Lineage for d1yspa1 (1ysp A:2-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188153] (2 PDB entries)

8. Domain d1yspa1: 1ysp A:2-172 [203224]
   Other proteins in same PDB: d1yspa2
   automated match to d1tf1c_
   complexed with so4

Details for d1yspa1

PDB Entry: 1ysp, 1.8 Å

PDB Description: Crystal structure of the C-terminal domain of E. coli transcriptional regulator KdgR.

PDB Compounds: (A:) Transcriptional regulator kdgR

SCOPe Domain Sequences for d1yspa1:

Sequence, based on SEQRES records:

>d1yspa1 d.110.2.0 (A:2-172) automated matches {Escherichia coli [TaxId: 562]}
dlirsadiqmrelsrltketihlgaldedsivyihkidsmynlrmysrigrrnplystai
gkvllawrdrdevkqilegveykrstertitsteallpvldqvreqgygedneeqeeglr
ciavpvfdrfgvviaglsisfptlrfseerlqeyvamlhtaarkisaqmgy

Sequence, based on observed residues (ATOM records):

>d1yspa1 d.110.2.0 (A:2-172) automated matches {Escherichia coli [TaxId: 562]}
dlirsadiqmrelsrltketihlgaldedsivyihkidsmigrrnplystaigkvllawr
drdevkqilegveykrstertitsteallpvldqvreqgygedneeqeeglrciavpvfd
rfgvviaglsisfptlrfseerlqeyvamlhtaarkisaqmgy

Timeline for d1yspa1:

• d1yspa1 first appeared in SCOPe 2.03, called d1yspa_
  
• d1yspa1 appears in SCOPe 2.07