Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [225035] (1 PDB entry) |
Domain d1yslb2: 1ysl B:168-383 [203223] automated match to d1xpma2 complexed with aae, coa, gol, so4 |
PDB Entry: 1ysl (more details), 1.9 Å
SCOPe Domain Sequences for d1yslb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yslb2 c.95.1.0 (B:168-383) automated matches {Enterococcus faecalis [TaxId: 1351]} ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey eamfaetldtdidqtledelkysisainntvrsyrn
Timeline for d1yslb2: