Lineage for d1yslb1 (1ysl B:1-167)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627560Species Enterococcus faecalis [TaxId:1351] [225035] (1 PDB entry)
  8. 1627563Domain d1yslb1: 1ysl B:1-167 [203222]
    automated match to d1tvza1
    complexed with aae, coa, gol, so4

Details for d1yslb1

PDB Entry: 1ysl (more details), 1.9 Å

PDB Description: Crystal structure of HMG-CoA synthase from Enterococcus faecalis with AcetoAcetyl-CoA ligand.
PDB Compounds: (B:) HMG-CoA synthase

SCOPe Domain Sequences for d1yslb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yslb1 c.95.1.0 (B:1-167) automated matches {Enterococcus faecalis [TaxId: 1351]}
mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvasepr

SCOPe Domain Coordinates for d1yslb1:

Click to download the PDB-style file with coordinates for d1yslb1.
(The format of our PDB-style files is described here.)

Timeline for d1yslb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yslb2