Lineage for d1yoja_ (1yoj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1125 PDB entries)
  8. 2546874Domain d1yoja_: 1yoj A: [203212]
    automated match to d2z8ca1

Details for d1yoja_

PDB Entry: 1yoj (more details), 1.95 Å

PDB Description: crystal structure of src kinase domain
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1yoja_:

Sequence, based on SEQRES records: (download)

>d1yoja_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe
klvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqiasgmayverm
nyvhrdlraanilvgenlvckvadfglarliednewtarqgakfpikwtapeaalygrft
iksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwr
kepeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d1yoja_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eipreslrlevklgqggevwmgtwngttrvaiktlmkklrheklvqlyavvseepiyivt
eymnkgslldflkgetgkylrlpqlvdmsaqiasgmayvermnyvhrdlraanilvgenl
vckvapikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergy
rmpcppecpeslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d1yoja_:

Click to download the PDB-style file with coordinates for d1yoja_.
(The format of our PDB-style files is described here.)

Timeline for d1yoja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yojb_