Lineage for d1beyh1 (1bey H:1-121)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363391Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 363421Domain d1beyh1: 1bey H:1-121 [20321]
    Other proteins in same PDB: d1beyh2, d1beyl1, d1beyl2
    part of antibody to CAMPATH-1H humanized Fab

Details for d1beyh1

PDB Entry: 1bey (more details), 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beyh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
s

SCOP Domain Coordinates for d1beyh1:

Click to download the PDB-style file with coordinates for d1beyh1.
(The format of our PDB-style files is described here.)

Timeline for d1beyh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beyh2