SCOP 1.63: Domain d1beyh1: 1bey H:1-121

Lineage for d1beyh1 (1bey H:1-121)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Antibody to CAMPATH-1H humanized fab, kappa L chain [48869] (1 PDB entry)

8. Domain d1beyh1: 1bey H:1-121 [20321]
   Other proteins in same PDB: d1beyh2, d1beyl2

Details for d1beyh1

PDB Entry: 1bey, 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyh1:

Sequence; same for both SEQRES and ATOM records:

>d1beyh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
s

Timeline for d1beyh1:

• d1beyh1 first appeared (with stable ids) in SCOP 1.55
  
• d1beyh1 appears in SCOP 1.61
  
• d1beyh1 appears in SCOP 1.65
  
• d1beyh1 appears in the current release, SCOPe 2.08