Lineage for d1beyh1 (1bey H:1-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7187Species Antibody to CAMPATH-1H humanized fab, kappa L chain [48869] (1 PDB entry)
  8. 7188Domain d1beyh1: 1bey H:1-121 [20321]
    Other proteins in same PDB: d1beyh2, d1beyl2

Details for d1beyh1

PDB Entry: 1bey (more details), 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beyh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
s

SCOP Domain Coordinates for d1beyh1:

Click to download the PDB-style file with coordinates for d1beyh1.
(The format of our PDB-style files is described here.)

Timeline for d1beyh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beyh2