SCOPe 2.08: Domain d1beyh1: 1bey H:6-121

Lineage for d1beyh1 (1bey H:6-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1beyh1: 1bey H:6-121 [20321]
   Other proteins in same PDB: d1beyh2, d1beyh3, d1beyl1, d1beyl2
   part of antibody to CAMPATH-1H humanized Fab

Details for d1beyh1

PDB Entry: 1bey, 3.25 Å

PDB Description: antibody to campath-1h humanized fab

PDB Compounds: (H:) campath-1h antibody

SCOPe Domain Sequences for d1beyh1:

Sequence; same for both SEQRES and ATOM records:

>d1beyh1 b.1.1.1 (H:6-121) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytteynps
vkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvss

Timeline for d1beyh1:

• d1beyh1 first appeared (with stable ids) in SCOP 1.55
  
• d1beyh1 appears in SCOPe 2.07