SCOPe 2.05: Domain d1ynpb_: 1ynp B:

Lineage for d1ynpb_ (1ynp B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (24 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [225042] (2 PDB entries)

8. Domain d1ynpb_: 1ynp B: [203209]
   automated match to d4asth_
   complexed with gol, na, so4, suc

Details for d1ynpb_

PDB Entry: 1ynp, 1.25 Å

PDB Description: aldo-keto reductase akr11c1 from bacillus halodurans (apo form)

PDB Compounds: (B:) Oxidoreductase

SCOPe Domain Sequences for d1ynpb_:

Sequence; same for both SEQRES and ATOM records:

>d1ynpb_ c.1.7.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
hmkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqf
vgkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikeavkdslrrlqtdyidlyqlh
ggtiddpidetieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrp
eewfpliqehgvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhel
alqyclahdvvatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre

Timeline for d1ynpb_:

• d1ynpb_ first appeared in SCOPe 2.03
  
• d1ynpb_ appears in SCOPe 2.04
  
• d1ynpb_ is called d1ynpb1 in SCOPe 2.06
  
• d1ynpb_ appears in the current release, SCOPe 2.08, called d1ynpb1